SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15603570|ref|NP_246644.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603570|ref|NP_246644.1|
Domain Number 1 Region: 17-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.63e-24
Family Thioltransferase 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603570|ref|NP_246644.1|
Sequence length 124
Comment hypothetical protein PM1705 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKLLTFVATCLLSVQAFAVDFKPFEQAAFDVALQSDKPVLVDVYANWCPTCKRQVNVLE
PMLKEAQFKDYTVFKVDYDEHKDALKHFNVTRQSTLILFNQGKEVRRSIAETSEDGLRRF
ITLP
Download sequence
Identical sequences A0A1D7R4E4 A0A2K2YMB7 J5MZ18 Q9CKB9 V4PZF6
gi|378775644|ref|YP_005177887.1| gi|383311734|ref|YP_005364544.1| WP_005718682.1.10027 WP_005718682.1.10721 WP_005718682.1.11014 WP_005718682.1.11214 WP_005718682.1.11947 WP_005718682.1.12156 WP_005718682.1.12311 WP_005718682.1.1307 WP_005718682.1.14908 WP_005718682.1.15732 WP_005718682.1.17217 WP_005718682.1.18123 WP_005718682.1.19996 WP_005718682.1.20287 WP_005718682.1.21657 WP_005718682.1.22153 WP_005718682.1.2313 WP_005718682.1.23830 WP_005718682.1.26616 WP_005718682.1.27416 WP_005718682.1.27592 WP_005718682.1.27664 WP_005718682.1.28084 WP_005718682.1.29697 WP_005718682.1.30617 WP_005718682.1.34253 WP_005718682.1.35562 WP_005718682.1.35978 WP_005718682.1.3807 WP_005718682.1.38246 WP_005718682.1.3839 WP_005718682.1.39152 WP_005718682.1.3957 WP_005718682.1.40210 WP_005718682.1.41297 WP_005718682.1.41351 WP_005718682.1.41462 WP_005718682.1.41657 WP_005718682.1.41667 WP_005718682.1.42469 WP_005718682.1.42512 WP_005718682.1.42943 WP_005718682.1.43687 WP_005718682.1.44741 WP_005718682.1.45422 WP_005718682.1.47685 WP_005718682.1.4808 WP_005718682.1.49053 WP_005718682.1.50853 WP_005718682.1.51342 WP_005718682.1.52066 WP_005718682.1.52585 WP_005718682.1.52859 WP_005718682.1.53852 WP_005718682.1.55401 WP_005718682.1.57420 WP_005718682.1.57956 WP_005718682.1.58257 WP_005718682.1.58450 WP_005718682.1.58628 WP_005718682.1.58910 WP_005718682.1.59455 WP_005718682.1.60478 WP_005718682.1.60664 WP_005718682.1.61098 WP_005718682.1.61860 WP_005718682.1.62016 WP_005718682.1.6219 WP_005718682.1.62389 WP_005718682.1.6332 WP_005718682.1.63549 WP_005718682.1.65482 WP_005718682.1.65878 WP_005718682.1.66934 WP_005718682.1.66990 WP_005718682.1.72215 WP_005718682.1.73917 WP_005718682.1.74955 WP_005718682.1.75804 WP_005718682.1.78987 WP_005718682.1.79347 WP_005718682.1.80223 WP_005718682.1.80589 WP_005718682.1.80911 WP_005718682.1.81885 WP_005718682.1.8281 WP_005718682.1.83579 WP_005718682.1.86541 WP_005718682.1.87897 WP_005718682.1.88402 WP_005718682.1.89773 WP_005718682.1.90081 WP_005718682.1.90179 WP_005718682.1.90578 WP_005718682.1.91495 WP_005718682.1.92478 WP_005718682.1.93940 WP_005718682.1.94432 WP_005718682.1.94435 WP_005718682.1.9746 WP_005718682.1.9947 272843.PM1705 gi|15603570|ref|NP_246644.1| gi|386835583|ref|YP_006240902.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]