SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15603666|ref|NP_246740.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603666|ref|NP_246740.1|
Domain Number 1 Region: 21-205
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.91e-39
Family DsbA-like 0.00000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603666|ref|NP_246740.1|
Sequence length 206
Comment DsbA family thiol:disulfide interchange protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKLVLAVTSFLFAVSVQATNLTEGKQYVTLNQAPVQQAEVIEFFSFYCPHCYSFEYEYQ
IPNKVKQQLPEGVSLKQYHVNFLGGEMGKNLTRAWALAMATGVQDKVKEPLFFAAQQNKL
RSMDDIRQIFLANGLSAEQFDGGINSFAVTALTNKQVTAAEHMKVRGVPDFYVNGRYRVN
PEGLKNDSHEAFVADYVETVKGLLQK
Download sequence
Identical sequences A0A1E3XKC4 A0A2K2YX72 Q9CK34 V4NCH9
gi|15603666|ref|NP_246740.1| gi|386835152|ref|YP_006240469.1| gi|378775138|ref|YP_005177381.1| gi|383311161|ref|YP_005363971.1| WP_005752287.1.10027 WP_005752287.1.10721 WP_005752287.1.11014 WP_005752287.1.11214 WP_005752287.1.11947 WP_005752287.1.12156 WP_005752287.1.12311 WP_005752287.1.1307 WP_005752287.1.14908 WP_005752287.1.15732 WP_005752287.1.17217 WP_005752287.1.18123 WP_005752287.1.19996 WP_005752287.1.20287 WP_005752287.1.21657 WP_005752287.1.22153 WP_005752287.1.2313 WP_005752287.1.23830 WP_005752287.1.26616 WP_005752287.1.26777 WP_005752287.1.27416 WP_005752287.1.27592 WP_005752287.1.27664 WP_005752287.1.28084 WP_005752287.1.29697 WP_005752287.1.30617 WP_005752287.1.34253 WP_005752287.1.35562 WP_005752287.1.35978 WP_005752287.1.36022 WP_005752287.1.3807 WP_005752287.1.38246 WP_005752287.1.3839 WP_005752287.1.39152 WP_005752287.1.3957 WP_005752287.1.40210 WP_005752287.1.40787 WP_005752287.1.41297 WP_005752287.1.41351 WP_005752287.1.41462 WP_005752287.1.41657 WP_005752287.1.41667 WP_005752287.1.4211 WP_005752287.1.42469 WP_005752287.1.42512 WP_005752287.1.42943 WP_005752287.1.43687 WP_005752287.1.44741 WP_005752287.1.45422 WP_005752287.1.47685 WP_005752287.1.4808 WP_005752287.1.49053 WP_005752287.1.50853 WP_005752287.1.51342 WP_005752287.1.52066 WP_005752287.1.52585 WP_005752287.1.52859 WP_005752287.1.53852 WP_005752287.1.55074 WP_005752287.1.55401 WP_005752287.1.57420 WP_005752287.1.57956 WP_005752287.1.58257 WP_005752287.1.58450 WP_005752287.1.58628 WP_005752287.1.58910 WP_005752287.1.59455 WP_005752287.1.60478 WP_005752287.1.60664 WP_005752287.1.61098 WP_005752287.1.61860 WP_005752287.1.62016 WP_005752287.1.6219 WP_005752287.1.62389 WP_005752287.1.6332 WP_005752287.1.63549 WP_005752287.1.65482 WP_005752287.1.65878 WP_005752287.1.66934 WP_005752287.1.66990 WP_005752287.1.72215 WP_005752287.1.73917 WP_005752287.1.74955 WP_005752287.1.75804 WP_005752287.1.78987 WP_005752287.1.79347 WP_005752287.1.80223 WP_005752287.1.80589 WP_005752287.1.80911 WP_005752287.1.81885 WP_005752287.1.8281 WP_005752287.1.83579 WP_005752287.1.86541 WP_005752287.1.87897 WP_005752287.1.88402 WP_005752287.1.89773 WP_005752287.1.90081 WP_005752287.1.90179 WP_005752287.1.90578 WP_005752287.1.91495 WP_005752287.1.92478 WP_005752287.1.93940 WP_005752287.1.94432 WP_005752287.1.94435 WP_005752287.1.95718 WP_005752287.1.9746 WP_005752287.1.9947 272843.PM1801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]