SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15603804|ref|NP_246878.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603804|ref|NP_246878.1|
Domain Number 1 Region: 27-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000392
Family Thioltransferase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603804|ref|NP_246878.1|
Sequence length 151
Comment hypothetical protein PM1939 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKLHKFTRSLLLLSLGITACAQAQTLSMEVWKSPTCGCCNEWISYMQKNGFEIKVNETGN
YDAHKRFNIKYEHASCHTAVIDGYVIEGHVPAEDIKRLLAEKPDAVGLSAPGMPIGSPGM
DGEAYGGRKDPYDVVLIKKNGESEVFKSYNQ
Download sequence
Identical sequences Q9CJQ5
WP_010907409.1.12311 WP_010907409.1.15732 WP_010907409.1.40210 WP_010907409.1.45422 WP_010907409.1.4808 WP_010907409.1.53852 WP_010907409.1.55074 WP_010907409.1.6219 WP_010907409.1.62389 WP_010907409.1.66990 WP_010907409.1.81885 WP_010907409.1.8281 WP_010907409.1.89773 WP_010907409.1.9746 WP_010907409.1.9947 gi|15603804|ref|NP_246878.1| 272843.PM1939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]