SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602387|ref|NP_245459.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602387|ref|NP_245459.1|
Domain Number 1 Region: 82-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.41e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0056
Further Details:      
 
Domain Number 2 Region: 11-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.27e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602387|ref|NP_245459.1|
Sequence length 212
Comment hypothetical protein PM0522 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTSAANKRSIMTLFSDKTDIYCHQVRIVLAEKGVAYETEVVDPQVVSEDLMELNPYGTLP
TLVDRDLVLFNSRIIMEYLDERFPHPPLMPVYPVARGKSRLLMLRIEQDWYPVLAKAEKG
TDAERAVALKQLREEILAIAPIFTQMPYFMSEEFSLVDCYIAPLLWRMQELGVDFSGAGS
KAIKAYMARVFERDSFMQSLGVSAPKNLMDEK
Download sequence
Identical sequences A0A1E3XJH1 A0A2K2YZJ9 Q9CNB0 V4MQL9
gi|15602387|ref|NP_245459.1| gi|383310161|ref|YP_005362971.1| gi|386834362|ref|YP_006239677.1| 272843.PM0522 gi|378774227|ref|YP_005176470.1| WP_005726291.1.10027 WP_005726291.1.10721 WP_005726291.1.11214 WP_005726291.1.11947 WP_005726291.1.12156 WP_005726291.1.12311 WP_005726291.1.1307 WP_005726291.1.14908 WP_005726291.1.15732 WP_005726291.1.17217 WP_005726291.1.18123 WP_005726291.1.19996 WP_005726291.1.20287 WP_005726291.1.22153 WP_005726291.1.2313 WP_005726291.1.23830 WP_005726291.1.24757 WP_005726291.1.26616 WP_005726291.1.26777 WP_005726291.1.27416 WP_005726291.1.27592 WP_005726291.1.27664 WP_005726291.1.28084 WP_005726291.1.29697 WP_005726291.1.30617 WP_005726291.1.34253 WP_005726291.1.35562 WP_005726291.1.35978 WP_005726291.1.36022 WP_005726291.1.3807 WP_005726291.1.38246 WP_005726291.1.3839 WP_005726291.1.39152 WP_005726291.1.3957 WP_005726291.1.40210 WP_005726291.1.40787 WP_005726291.1.41297 WP_005726291.1.41351 WP_005726291.1.41462 WP_005726291.1.41657 WP_005726291.1.41667 WP_005726291.1.42512 WP_005726291.1.42943 WP_005726291.1.43687 WP_005726291.1.44741 WP_005726291.1.45422 WP_005726291.1.47685 WP_005726291.1.4808 WP_005726291.1.49053 WP_005726291.1.50853 WP_005726291.1.52066 WP_005726291.1.52859 WP_005726291.1.53852 WP_005726291.1.55401 WP_005726291.1.57420 WP_005726291.1.57956 WP_005726291.1.58111 WP_005726291.1.58257 WP_005726291.1.58450 WP_005726291.1.58628 WP_005726291.1.58910 WP_005726291.1.59455 WP_005726291.1.60478 WP_005726291.1.60664 WP_005726291.1.61098 WP_005726291.1.61860 WP_005726291.1.62016 WP_005726291.1.6219 WP_005726291.1.62389 WP_005726291.1.6332 WP_005726291.1.63549 WP_005726291.1.65482 WP_005726291.1.65878 WP_005726291.1.66934 WP_005726291.1.66990 WP_005726291.1.70689 WP_005726291.1.72215 WP_005726291.1.73917 WP_005726291.1.74955 WP_005726291.1.75804 WP_005726291.1.78987 WP_005726291.1.79347 WP_005726291.1.80223 WP_005726291.1.80589 WP_005726291.1.80911 WP_005726291.1.81885 WP_005726291.1.8281 WP_005726291.1.83579 WP_005726291.1.86541 WP_005726291.1.87897 WP_005726291.1.88402 WP_005726291.1.89773 WP_005726291.1.90081 WP_005726291.1.90179 WP_005726291.1.91495 WP_005726291.1.92478 WP_005726291.1.93940 WP_005726291.1.94432 WP_005726291.1.94435 WP_005726291.1.95718 WP_005726291.1.9746 WP_005726291.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]