SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602439|ref|NP_245511.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602439|ref|NP_245511.1|
Domain Number 1 Region: 44-115,149-202
Classification Level Classification E-value
Superfamily TPR-like 0.00000285
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 
Domain Number 2 Region: 2-44
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000306
Family Thioltransferase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602439|ref|NP_245511.1|
Sequence length 217
Comment hypothetical protein PM0574 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MVAAQFRIQTLPTTYLFKEAQALDAFPGILDEQALQQRLALILPKEDEIKFMQALEWLEA
ENFEQALPLLKEAWELSAKKNSDIALLYAETYIAMKKVEPAQDILNQIPLQDRDNRWQGL
QAQIELLIQAADTPEIQQLQSEFAKNPSPQIALKLALQLHQANRNEEALSLLFDFLKRDL
NAENGEIKQQFLAMLTAIGQNDPVSNKYRRLLYSLLY
Download sequence
Identical sequences Q9CN65
gi|15602439|ref|NP_245511.1| 272843.PM0574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]