SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC1F5.07c from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC1F5.07c
Domain Number 1 Region: 1-338,450-483
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.66e-27
Family FAD-linked reductases, N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 323-432
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.67e-24
Family L-aminoacid/polyamine oxidase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPAC1F5.07c
Sequence length 490
Comment |hem14||protoporphyrinogen oxidase |Schizosaccharomyces pombe|chr 1|||Manual
Sequence
MSIAICGGGIAGLSTAFYLARLIPKCTIDLYEKGPRLGGWLQSVKIPCADSPTGTVLFEQ
GPRTLRPAGVAGLANLDLISKLGIEDKLLRISSNSPSAKNRYIYYPDRLNEIPSSILGSI
KSIMQPALRPMPLAMMLEPFRKSKRDSTDESVGSFMRRRFGKNVTDRVMSAMINGIYAGD
LNDLSMHSSMFGFLAKIEKKYGNITLGLIRALLAREILSPAEKALKAALLAEPKTAELSN
SMKSTSMFAFKEGIETITLSIADELKKMPNVKIHLNKPAKTLVPHKTQSLVDVNGQAYEY
VVFANSSRNLENLISCPKMETPTSSVYVVNVYYKDPNVLPIRGFGLLIPSCTPNNPNHVL
GIVFDSEQNNPENGSKVTVMMGGSAYTKNTSLIPTNPEEAVNNALKALQHTLKISSKPTL
TNATLQQNCIPQYRVGHQDNLNSLKSWIEKNMGGRILLTGSWYNGVSIGDCIMNGHSTAR
KLASLMNSSS
Download sequence
Identical sequences Q10062
4896.SPAC1F5.07c-1 SPAC1F5.07c NP_592866.1.19918 SPAC1F5_07c.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]