SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC23C11.05 from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC23C11.05
Domain Number 1 Region: 4-284
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.36e-109
Family Inorganic pyrophosphatase 0.00000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPAC23C11.05
Sequence length 289
Comment |||inorganic pyrophosphatase |Schizosaccharomyces pombe|chr 1|||Manual
Sequence
MSEYTTREVGALNTLDYQVYVEKNGTPISSWHDIPLYANAEKTILNMVVEIPRWTQAKLE
ITKEATLNPIKQDTKKGKLRFVRNCFPHHGYIWNYGAFPQTYEDPNVVHPETKAKGDSDP
LDVCEIGEARGYTGQVKQVKVLGVMALLDEGETDWKVIVIDVNDPLAPKLNDIEDVERHM
PGLIRATNEWFRIYKIPDGKPENSFAFSGECKNRKYAEEVVRECNEAWERLITGKTDAKS
DFSLVNVSVTGSVANDPSVSSTIPPAQELAPAPVDPSVHKWFYISGSPL
Download sequence
Identical sequences P19117
SPAC23C11.05 SPAC23C11_05.1 4896.SPAC23C11.05-1 NP_593636.1.19918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]