SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC3A12.02 from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC3A12.02
Domain Number 1 Region: 11-276
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.83e-90
Family Inorganic pyrophosphatase 0.000000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPAC3A12.02
Sequence length 286
Comment |||mitochondrial inorganic diphosphatase |Schizosaccharomyces pombe|chr 1|||Manual
Sequence
MASLAKNILQFRSKITGKLNTPDFRVYCYKNNKPISFFHDVPLTSDKDTFNMVTEIPRWT
QAKCEISLTSPFHPIKQDLKNGKLRYVANSFPYHGFIWNYGALPQTWEDPNVIDSRTKMK
GDGDPLDVCEIGGSIGYIGQIKQVKVLGALGLIDQGETDWKILAIDINDPRAKLLNDISD
VQNLMPRLLPCTRDWFAIYKIPDGKPKNRFFFDGNYLPKSDALDIIAQCHQHWKVSRDRK
QYIKNFHNESVNNVDLINKINSLKEEVSQNVSNYPSFPYFHTIPNL
Download sequence
Identical sequences P87118
SPAC3A12.02 SPAC3A12.02___KOG1626 4896.SPAC3A12.02-1 SPAC3A12_02.1 NP_593328.1.19918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]