SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPBC354.15 from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPBC354.15
Domain Number 1 Region: 5-222,335-392
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.91e-34
Family FAD-linked reductases, N-terminal domain 0.005
Further Details:      
 
Weak hits

Sequence:  SPBC354.15
Domain Number - Region: 223-334
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00286
Family D-aminoacid oxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPBC354.15
Sequence length 412
Comment |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe|chr 2|||Manual
Sequence
MVKNTSVIIVGAGVFGLSAALELTKRGGYTIKILDRAPPPVIDGSSVDANRIIRSDYADA
VYCSMGIDALEEWRTNPLFKEQFYGSGLMFVGRDNVEYRDMSLENLTKMGVSAAKFQTTE
ELRKLFPKWIGELNDGEAGYANFSSGWANAEQSVKSVVNYLAHAGVSFISGPEGTVEELI
TEENVVKGVRTTTGAYMAEKLIFATGAWTASLLPNDHTRFLATGQPVAYIKLTPEEYIRF
LTNPVYLDFDTGFYIFPPTPDGYLKFARHGYGFTRMQNLKSGKVESVPPKKPLVSPILPK
EAELDLRRNLQRTYGEEISQRPFYKTRICYYTDTADAEFVFDYHPDYENLFVCTGGSGHG
FKFFPILGKYSIGCMFRELEEPLLKKWRWKKENLEFAALDHSRAGPSRQELS
Download sequence
Identical sequences O43029
SPBC354.15 SPBC354_15.1 NP_595239.1.19918 4896.SPBC354.15-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]