SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPCC1223.03c from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPCC1223.03c
Domain Number 1 Region: 57-179,210-292
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-40
Family HI0933 N-terminal domain-like 0.069
Further Details:      
 
Domain Number 2 Region: 311-405
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000216
Family D-aminoacid oxidase-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPCC1223.03c
Sequence length 649
Comment |gut2||glycerol-3-phosphate dehydrogenase Gut2|Schizosaccharomyces pombe|chr 3|||Manual
Sequence
MFSIFKRRSVQAALAASGLVGGAVFYSDFIKRPAPSHFNPQFTPFTKSLAPPPSRETLLK
NVEDISKFDVLIIGGGATGTGVAVDASTRGLNVCLLEKTDFASETSSKSTKMAHGGVRYL
EKAVFQLSKAQLDLVIEALNERANMLRTAPHLCTVLPIMIPVYKWWQVPYFFVGCKIYDW
VAGSKNLRASTIFSKETTVAIAPMLDDSNLKASCVYHDGSFNDTRMNTTLAVTAIDNGAT
VLNYMEVKKLLKSKDNKLEGVLAIDRETGKEYQIKATSVVNATGPFSDKILEMDADPQGE
PPKTAQFPRMVVPSAGVHVVLPEYYCPPNIGILDPSTSDNRVMFFLPWQGKVIAGTTDKP
LSSVPTNPTPSEDDIQLILKELQKYLVFPVDREDVLSAWCGIRPLVRDPSTVPPGTDPTT
GETQGLVRSHFIFKSDTGLLTISGGKWTTYREMAEETVNELIKDHDFGKALKPCQTKKLI
LVGGENYYKNYSARLIHEYHIPLRLAKHLSHNYGSRAPLILELYSKTDFNKLPVTLADKE
VFAPSSDASSDKSVSYASFDEPFTVAELKYSIKYEYTRTPTDFLARRTRLAFLDARQALQ
AVAGVTHVMKEEFGWDDATTDKLAQEARDYIGGMGVSSDRFDVKQFEVK
Download sequence
Identical sequences O14400
SPCC1223.03c 4896.SPCC1223.03c-1 NP_588348.1.19918 SPCC1223_03c.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]