SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPCC1450.07c from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPCC1450.07c
Domain Number 1 Region: 5-216,284-335
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.35e-25
Family D-aminoacid oxidase, N-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 203-298
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.01e-24
Family D-aminoacid oxidase-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPCC1450.07c
Sequence length 348
Comment |||D-amino acid oxidase |Schizosaccharomyces pombe|chr 3|||Manual
Sequence
MTKENKPRDIVIVGAGVIGLTTAWILSDLGLAPRIKVIAKYTPEDRSVEYTSPWAGANFC
SISATDDNALRWDKITYHRFAYLAKTRPEAGIRFADLRELWEYEPKHDKIRSWNTYVRDF
KVIPEKDLPGECIYGHKATTFLINAPHYLNYMYKLLIEAGVEFEKKELSHIKETVEETPE
ASVVFNCTGLWASKLGGVEDPDVYPTRGHVVLVKAPHVTETRILNGKNSDTYIIPRPLNG
GVICGGFMQPGNWDREIHPEDTLDILKRTSALMPELFHGKGPEGAEIIQECVGFRPSRKG
GARVELDVVPGTSVPLVHDYGASGTGYQAGYGMALDSVMLALPKIKLA
Download sequence
Identical sequences Q9Y7N4
SPCC1450.07c NP_588306.1.19918 SPCC1450_07c.1 4896.SPCC1450.07c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]