SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPMTR.02 from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPMTR.02
Domain Number 1 Region: 107-159
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000423
Family Homeodomain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPMTR.02
Sequence length 159
Comment |matPi||P-specific polypeptide Pi|Schizosaccharomyces pombe|chr mating_type_region|||Manual
Sequence
MKRVAVLLKTVMCEFLKCDYNGYDRIISLLRRILTLICTPNLNGLTIKRVIDSMQSLEYI
KQTCNFKLQMCISSMAFKRNNALQNCNHYAWCDDHCSDIGRPMTTVRGQCSKCTKPHLMR
WLLLHYDNPYPSNSEFYDLSAATGLTRTQLRNWFSNRRR
Download sequence
Identical sequences P10842 Q6WRX8
SPMTR.02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]