SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPAC57A10.09c from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC57A10.09c
Domain Number 1 Region: 8-88
Classification Level Classification E-value
Superfamily HMG-box 9.69e-28
Family HMG-box 0.0000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPAC57A10.09c
Sequence length 108
Comment |nhp6||High-mobility group non-histone chromatin protein|Schizosaccharomyces pombe|chr 1|||Manual
Sequence
MPRAAKSSRKKDPNTPKRNMSAFMFFSIENREKMKTDNPDATFGQLGSLLGKRWKELTST
EREPYEEKARQDKERYERERKEYDTKLANGEKTGKASAPAAAAAAKEE
Download sequence
Identical sequences P87057
4896.SPAC57A10.09c-1 SPAC57A10.09c SPAC57A10_09c.1 NP_593314.1.19918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]