SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPBC1198.13c from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPBC1198.13c
Domain Number 1 Region: 17-124
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 7.59e-26
Family Rap30/74 interaction domains 0.0027
Further Details:      
 
Domain Number 2 Region: 189-254
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.2e-22
Family DNA-binding domain from rap30 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPBC1198.13c
Sequence length 307
Comment |tfg2|SPBC660.03c|transcription factor TFIIF complex beta subunit Tfg2 |Schizosaccharomyces pombe|chr 2|||Manual
Sequence
MSEEKPTVRTEEDDRYEDDAGDLDLGQIGSRVWLVKIPKFLMDKWNSIPEDDAANLGCVR
VKNDEIQLLLQNSPENADVPKIYNLRVMNKFVRNSYVFRESETSSSMKSTALVGTVAHEC
NVSPVINDDYRRVMQKRALAASAPKRKVQMIDDRGGSLLAPGTLGSRSRSTTSFIRNVKP
RTGEGLKNSRIPRNELLDILFKCFEDYEYWTLKGLREYVKQPEVYLKEVLDSIAILNKRG
PYALKYSLKPEYKGTMDAASVELRNQQASQSESSSIDHTGKNTSPDNPGTNAEEDEDDDG
VEMIDVV
Download sequence
Identical sequences O94424
NP_595082.1.19918 SPBC1198_13c.1 4896.SPBC1198.13c-1 SPBC1198.13c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]