SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPBC216.02 from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPBC216.02
Domain Number 1 Region: 862-957
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000315
Family Pleckstrin-homology domain (PH domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPBC216.02
Sequence length 968
Comment |mcp5|num1, mug21|cortical anchoring factor for dynein Mcp5/Num1|Schizosaccharomyces pombe|chr 2|||Manual
Sequence
MEKKQDNEVELYSIDLKNRNESAKIKLAYAKALEESILCETRKIEQEIKDQVVQKENKTY
FNNKFDNRYKLRDLEKNLAEEEVRITEMLTIQRQDIAIERRKNTNCFSESSQVDQYSVTE
TNLQYATNIGLNLLQQLRYLRLQLSEKEDLHKKLSVDNAHLIKQLDLLSSNMKTLMKEKT
KVQGQRDLLEQRLQGLMKKLTEVESLTVSLNDEKNKLTLELTNLRICLHELQLNAEKGET
IDESEDSKNTLVTEDENDDSVFLESSSDKYFDSSSFDAEQEEKHDFPIDPFLSLESNVQT
SVSQSSAVLKSINLAKQELVSVNHLVADDTKTPSPNLSSEIIENTKADIKKSIRSLNKAV
SPENSIDIEDETDRDDEFICFLLSYQQLQKALKSNLGLFQLSCLYPLSLNHLIQSFFQSL
TSQISIKDIDSKNKQVIKLFKPTKSSDRQEIFELAQFEPRQKFPIDTNSSKCDMSASTEM
HLKDTEKFANFKLKENILNHSSIYERDVSYLPALNKGGRENYLNNRVSSYRLVKPILNSY
GNHVLNRIQHDILENHFCCLKNVKDFVCGANTISMQWNLQKNMEFISSVFSLIKNEVNDT
SANSVILRTDALSNVATTRLKRKLTSAIIDCSIPRRRLRHYSNPEIAEFKNFRLSTDISH
SNVRNSKKLCSNGSMNCMRQGKAVFPRKIPYQEHDWEQWEKIAQSSMFKNRSIASRQSLE
TSDVTLDINMSSRHSNGTSSMLFKDFTKHNNWEASTYPSAPKNTRTYPTAEVEKTRHDSS
QSARQLKARSTATTISISLSTVSDVFTLPRNNLKSKTNTKKCRDNLNLSGLSSSTCNANS
VNKLMKHVMMGNEMMKYPRSESFKMFKKSHWRYFWINPHCEMLCWSKTNPFIEKGRKNQV
KSVKIKGMTIIKAPDALKNANLHNEVIVMQTTDKPIVLKAKSKKIHNIWVQAIKQINHKA
IFDTKPGI
Download sequence
Identical sequences Q9Y7J9
SPBC216.02 4896.SPBC216.02-1 NP_595354.1.19918 SPBC216_02.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]