SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPCC18B5.07c from Schizosaccharomyces pombe

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPCC18B5.07c
Domain Number 1 Region: 447-559
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-26
Family Ran-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPCC18B5.07c
Sequence length 565
Comment |nup61||nucleoporin Nup61|Schizosaccharomyces pombe|chr 3|||Manual
Sequence
MSKRGADHQLTKDQDDSDDDRHGPVEVPKEASADVMATRKIAKPKSRKRPTSGVSSPGIF
ANLAAKPVSLPASTTQFTFGKPAVTANNDSDIHLKKRGLNKSFIDAVIKSVDNNPFGNLS
PLFDEYRQHFSSIEKKPAEGNAFIVSTSFLSNVFLEQPTSNAVVSEVNPQQQKSQDSSSF
VTEKPASSEKEDKEKPLVPPGAPRFGFSAPALGSSFQFNSSAFTPKGSFGEKSATEAEAK
EKETSSNQTATGTAATTTNQFSFNTAANPFAFAKKENEESKPLTPVFSFSTTMASADASK
ETKQTHETKDSKSEESKPSNNEKSENAVEPAKGNTMSFSWTPDKPIKFDTPEKKFTFTNP
LSSKKLPASSDVKPPSAAAVGFSFGTTTNPFSFAAPKSSFPTSSTPASVGAEKSEETSNG
NKSEQEEKENGNDETRSNDSLVSGKGKGEENEDSVFETRAKIYRFDATSKSYSDIGIGPL
KINVDRDTGSARILARVEGSGKLLLNVRLCQDFEYSLAGKKDVKVPAASTDGKSIEMYLI
RVKEPSTAEKLLAELNEKKVSKSEN
Download sequence
Identical sequences 4896.SPCC18B5.07c-1 SPCC18B5_07c.1 SPCC18B5.07c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]