SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379734701|ref|YP_005328207.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379734701|ref|YP_005328207.1|
Domain Number 1 Region: 4-357
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.96e-52
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379734701|ref|YP_005328207.1|
Sequence length 360
Comment hypothetical protein BLASA_1232 [Blastococcus saxobsidens DD2]
Sequence
MTDLLAIGTRKGLWLARSDDDRRTWTLDGPHLLAQEIAAVSIDTRRPAPRLLAGVQYGHW
GPTVTWSDDLGGSWHETDSGAIRFPEDTGAALGRVWQLRPDSGDRPDVVWAGCEPQSLWR
STDGGCSFTLVRGLWDHPHRPTWEPGAGGGAVHTVLPDPATDRMTVAMSTGGVYVSEDGA
TGWAPHSRGISAVFMPDPAPEYGQCVHKVAVDAGDPRRMYAQNHFGVFRTDDGGASWTSI
ADGLPADFGFPVAASPATPGTAWVVPLVADMQRVPPGGRLRVHRTRDAGGSWTEVGAGLP
DGAWTAVLRDALCTDDHEVTGVYVGTRDGCVYASTDEGDTFSTVAEHLPDVLVVRAARLP
Download sequence
Identical sequences H6RWW0
WP_014375071.1.69969 gi|379734701|ref|YP_005328207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]