SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379734878|ref|YP_005328384.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379734878|ref|YP_005328384.1|
Domain Number 1 Region: 84-217
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.04e-24
Family GntR ligand-binding domain-like 0.0079
Further Details:      
 
Domain Number 2 Region: 13-105
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000444
Family GntR-like transcriptional regulators 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379734878|ref|YP_005328384.1|
Sequence length 218
Comment putative Transcriptional regulator, GntR family [Blastococcus saxobsidens DD2]
Sequence
MEKLSGIPLVERPPTLARRAYLQLHQAIRDGAIRQDVLYSENELAETLGMSRTPVREAVL
SLSREGLIVIESQRGFRLRTLSAEERQEIFDLRSLLEGYAARRLAAAASSQQVRRLRELI
DAQEHLGSVGQESAFLSLDERFHLLQPEMLGLERTHDTLVSLRGAMWLIGYEALSLPRRH
ENVIAEHRAIVDAITRRDPEAAATAAQAHIHRTAAAVL
Download sequence
Identical sequences H6RJP6
WP_014375248.1.69969 gi|379734878|ref|YP_005328384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]