SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379735093|ref|YP_005328599.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379735093|ref|YP_005328599.1|
Domain Number 1 Region: 372-507
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.66e-18
Family GntR ligand-binding domain-like 0.0028
Further Details:      
 
Domain Number 2 Region: 301-383
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000126
Family GntR-like transcriptional regulators 0.026
Further Details:      
 
Weak hits

Sequence:  gi|379735093|ref|YP_005328599.1|
Domain Number - Region: 19-77
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00161
Family FIS-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379735093|ref|YP_005328599.1|
Sequence length 526
Comment GntR family transcriptional regulator [Blastococcus saxobsidens DD2]
Sequence
MSDPQLEDLSRDADEAVRLRARLVRDVLSLGPTRAAREHGVTRQTAAKWAQRYRTGGAAQ
LSRPAHRRRSTQELRRAALTAPLWMPTTKWSSRSIAEALGVSQSFVARAWEEMRSGTPLG
DDLTAAMIGRQPAILGLLVTSEAAVVAFQLTPVTRQETPDPPTRGDPAVHRSLRTLLAAD
LVRPELPATPAAAPRAFWEEVRNAADPDATVMALASDAAPVPAEVSVGGVCRDAHEWLSL
FPFLLDRGPLLSPAAALQLEAGLRTWARTPRHAFTWVRPPTPAGSSRGPAMRAAVRHLGP
ERALADEVVLTIRQGIAEGRLAGGDRVTERYLSGRLRTTRAQVRTAMRLLERDGLLTITT
GHAAVVPVLTTNDVVETYAARRALGALVIRAAVRWSPQKRQSVAESLDALERCAVTGNVH
RTGDADIAFQDALAHASGLVRIAPMLEVLADHLRMFIAVMGLDYAYPIDAMVRDDRALFE
AIDSGDADAAVHRWRIKIDDAAAYMLGQLPAPGPRPTGGKLPGSRT
Download sequence
Identical sequences H6RMD0
WP_014375459.1.69969 gi|379735093|ref|YP_005328599.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]