SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379736215|ref|YP_005329721.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379736215|ref|YP_005329721.1|
Domain Number 1 Region: 331-482
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.2e-33
Family GGDEF domain 0.00038
Further Details:      
 
Weak hits

Sequence:  gi|379736215|ref|YP_005329721.1|
Domain Number - Region: 154-286
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0497
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379736215|ref|YP_005329721.1|
Sequence length 495
Comment putative Diguanylate kinase [Blastococcus saxobsidens DD2]
Sequence
MSRGTGSKPTKGRTTGALVLSGLLVGVMGVLGLVSTHSAGALAIDQHREDRVDQTRVLGQ
LTAQTVRNAFHQLAAVLALQDEDGVPPFSAEPGNGPAADRDTARVRRIVEMSAGAMELGA
AVFNTRGQVVASYSPTGASASPTDPGFRPLVTAATDPGAGRIPISGIVTIDDEPALALGA
PATLSDGTSGLFVCFWSARSTTTEFFTAGEGEGWIVDAEGLVVGAPDPALIGTSLPYPAA
LQAARSGGDHGIVDTDDGGTDHVSAWQDIDGTTWTVLNVQTRDAFQGHLERASLRTELLV
LGMLLTTGTALVVLSRRRERAMAVIASTDELTRIHNRRGWFELAEQELARAARAGETRLA
VFLDLDGLKQVNDVLGHEEGDRAIASAAAVLRAACRSGDVLGRLGGDEFVVLLGDGADAA
VARRRVHEALDDFNAGSSAAFELRFSIGAEPWDPERPCSVEDLVRRADERMYADKQSRTD
RYDNLIRVPAKVPVG
Download sequence
Identical sequences H6RKS4
gi|379736215|ref|YP_005329721.1| WP_014376573.1.69969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]