SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379736309|ref|YP_005329815.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379736309|ref|YP_005329815.1|
Domain Number 1 Region: 9-82
Classification Level Classification E-value
Superfamily Homeodomain-like 1.26e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0032
Further Details:      
 
Domain Number 2 Region: 100-178
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000668
Family Tetracyclin repressor-like, C-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379736309|ref|YP_005329815.1|
Sequence length 214
Comment hypothetical protein BLASA_2913 [Blastococcus saxobsidens DD2]
Sequence
MSVVAPPDRRRRRRQETIEQVLDVALEVMAEQGAAGLTLGEVARRMGIRPPSLYGYFDGK
HALYDALFERGWRALLETLRAAGAIDQTADPLTGLRNGTTLLVRWAVEHPAQSALMFWRP
VPGFAPSERAYAPAVELDVESRALLARLRDAGHLAPDVDLERAYRAWTALVGGVISQQLS
NAPGEPFETGAFTAVLPDVMEMWLDHHRRNPSAR
Download sequence
Identical sequences H6RLQ8
gi|379736309|ref|YP_005329815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]