SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379736503|ref|YP_005330009.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379736503|ref|YP_005330009.1|
Domain Number 1 Region: 81-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000484
Family NfeD domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379736503|ref|YP_005330009.1|
Sequence length 145
Comment hypothetical protein BLASA_3109 [Blastococcus saxobsidens DD2]
Sequence
MAAWLLWLIGAGLLAVGEVMTLDLMLLMLAGGALGGMTVALLGGAAILQIVTFIVVSGVL
LALVRPIATKHLTNRTPLQLDGVDTLIGKTAKVSTDVDSSGGRIRLGADEWSARSQHGGE
FFAVGETVRILQVDGATAVVGDALE
Download sequence
Identical sequences H6RPB9
gi|379736503|ref|YP_005330009.1| WP_014376858.1.69969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]