SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379737274|ref|YP_005330780.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379737274|ref|YP_005330780.1|
Domain Number 1 Region: 15-73
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000000000000628
Family F1F0 ATP synthase subunit C 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379737274|ref|YP_005330780.1|
Sequence length 76
Comment ATP synthase, subunit c, F0 sector [Blastococcus saxobsidens DD2]
Sequence
MIEVLAELEGSIGSVGYGIATIGPGIGVGLVWAAYIQATARQPESAGLTRTYAFLGFALA
EALALIGFVAPLVYGT
Download sequence
Identical sequences H6RXE2
gi|379737274|ref|YP_005330780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]