SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|33240571|ref|NP_875513.1| from Prochlorococcus marinus subsp. marinus str. CCMP1375

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33240571|ref|NP_875513.1|
Domain Number 1 Region: 213-367
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.25e-42
Family Histidine kinase 0.00078
Further Details:      
 
Domain Number 2 Region: 4-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.03e-27
Family KaiB-like 0.0029
Further Details:      
 
Domain Number 3 Region: 134-199
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000628
Family Homodimeric domain of signal transducing histidine kinase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|33240571|ref|NP_875513.1|
Sequence length 381
Comment Signal transduction histidine kinase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
Sequence
MNKATANERKKLRLLLVASRKHLSRGDLRSLIRFLESEDCGFEIKLQFSDPKEQPELLEL
HRLVAIPALIKLDPQPKQIFAGTSILEQLKNWLPRWEQEDILISSGLGINLRQKESENGR
TRNELLLEDENLVLRQENETLSNQIESQERLLRMVAHELRTPLSAAKLALQSQALGQIDL
IKLQEVVKRRLEEIESLSKDLLEVGTTRWEALFNPQEANLANIAAEVILELEKFWLSRGI
GINTDIPADLPNVFADQSRMKQVLLNLIENALKFSNDGDTVEITMLHRTNQWVQISVSDK
GPGIPEEEQQRIFLDRVRLPQTSNETSGFGIGLSVCRRIVEVHGGKIWVVSQPGEGSCFY
FTVPVWDKRNKSLEPLTLTQG
Download sequence
Identical sequences Q7BWI3
NP_875513.1.92868 WP_011125273.1.25276 WP_011125273.1.37041 WP_011125273.1.47494 WP_011125273.1.71786 WP_011125273.1.74834 167539.Pro1121 gi|33240571|ref|NP_875513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]