SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s05650.1|PACid:18236541 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s05650.1|PACid:18236541
Domain Number 1 Region: 642-662,708-957
Classification Level Classification E-value
Superfamily HAD-like 2.53e-55
Family Meta-cation ATPase, catalytic domain P 0.00019
Further Details:      
 
Domain Number 2 Region: 444-530
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.31e-22
Family Calcium ATPase, transduction domain A 0.0058
Further Details:      
 
Domain Number 3 Region: 113-187
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 3.27e-17
Family HMA, heavy metal-associated domain 0.0012
Further Details:      
 
Domain Number 4 Region: 40-111
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000000000301
Family HMA, heavy metal-associated domain 0.0011
Further Details:      
 
Domain Number 5 Region: 186-256
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000000314
Family HMA, heavy metal-associated domain 0.0025
Further Details:      
 
Domain Number 6 Region: 383-428,531-636
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000445
Family Calcium ATPase, transmembrane domain M 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s05650.1|PACid:18236541
Sequence length 974
Sequence
MGSDGEMKINGKADDDLKAPLLKPSEDVAITVFPDKGDKKVRTVKFKIGEIKCTSCSTSI
ESMLGEVHGVESAVISPLDGRAAITYVPELVDVNKIKETIEDAGFPVDEFPEHDIEVCRL
RIKGMMCTSCSESVERVLLMADGVKKAVVGLALEEAKVHFDPNLIDTDGILEAVQDAGFG
AELISSGNDMNKVHLKVEGFNFAEDGNMIQSCLESTPGVNHVEVDLAEHKVTVCYDPDLI
GPRSIIQRIGDASSGPNIYHAELYVPPRRRETEQLQEVRMYRNQFLLCCLFSVPVLVFSM
VLPMLHPYGNWLEYRIHNMLTVGMLLRLILCTPVQFIVGRRFYVGSYHALRRKSANMDVL
VALGTNAAYFYSVYMVIKAITSDTFEGQDFFETSAMLISFILLGKYLEVVAKGKTSDALA
KLTELAPDTAHLVTVDSDGNVVSEMDISTELIQRNDMIKIVPGEKVPVDGIVIDGQSYVN
ESMITGEARPIAKRPGDKVIGGTMNENGCLLVRATHVGSETALSQIVQLVEAAQLSRAPV
QKLADRISKIFVPTVVIAAFITWLGWFIPGEAGLYPKHWIPKAMDRFELALQFGISVLVV
ACPCALGLATPTAVMVATGKGASQGVLIKGGNALQKAHKVKTVVFDKTGTLTVGKPEVVS
AVLFSSFSMEEFCDMVTAAEANSEHPIAKAVVKHAKRLRQKIAPNAEYIAEVKDFEVHTG
AGVSGKVGDRNVLVGNRRLMQSCNVSVGSEVENYIREHEQLARTCVLVAIDGGVAGAFAV
TDPVKPEAECVISFLRSMGISSIMVTGDNWATASAIAKEVGIEKVFAETDPLGKADRIKD
LQGKGMTVAMVGDGINDSPALVAADVGMAIGAGTDVAIEAADIVLIKSNLEDVVTAIDLS
RKTMSRIRLNYVWALGYNILGMPIAAGILYPFTGIRLPPWLAGACMAASSLSVVCSSLML
QSYKKPLRVRDRAS
Download sequence
Identical sequences B9GM73
XP_002299234.1.11743 3694.eugene3.00010321 POPTR_0001s05650.1|PACid:18236541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]