SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s05790.1|PACid:18238028 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s05790.1|PACid:18238028
Domain Number 1 Region: 116-233,333-444,802-1013
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.44e-118
Family Calcium ATPase, transmembrane domain M 0.001
Further Details:      
 
Domain Number 2 Region: 449-468,606-857
Classification Level Classification E-value
Superfamily HAD-like 4.92e-54
Family Meta-cation ATPase, catalytic domain P 0.00029
Further Details:      
 
Domain Number 3 Region: 456-661
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.89e-48
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0041
Further Details:      
 
Domain Number 4 Region: 234-329
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.27e-26
Family Calcium ATPase, transduction domain A 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s05790.1|PACid:18238028
Sequence length 1038
Sequence
MEKYLKENFVVDAKRPSDEALRRWRSAVSVVRNPRRRFRMVADLAKRAEAEKKRQNLQEK
IRIALYVKKAALHFIEAANRVEHKLSDNVRQTGFGIEPDELAAIVRSQDNKALESHGGVE
GLAREVSVSLNDGVVSSDISIRQNIYGPNKYAEKPARSLWMFVWDALHDLTLIILMACAV
VSVGVGIATEGWPNGMYDGVGIVLCILLVVMVTAISDYRQSLQFKVLDKEKKNVTVQVTR
EGRRQKVSIFDLVVGDVVHLSIGDVVPADGILISGHSLSVDESSLSGESEPVNINEKKPF
LLSGTKVQDGSGKMLVTAVGMRTEWGKLMVTLSEVGEDETPLQVKLNGVATIIGKIGLAF
AVMTFLVLMARFLVAKAHNHEITKWSSGDALQLLNFFAIAVTIIVVAVPEGLPLAVTLSL
AFAMKQLMKDRALVRHLSACETMGSACCICTDKTGTLTTNHMVVNKIWICEKTKSIQTND
NKDLLMSSVSEDVHGILLQSIFQNTGSEVTKGKDGKTNILGTPTETAIVEFGLLLGGDFK
THHIESEIVKVEPFNSEKKKMSVLVSLPDNSRFRAFCKGASEIILKMCDKILTADGKSVP
LSENQRQNITDVINGFACEALRTLCFAFKDIEKTSDADSIPDNNYTLIAVVGIKDPVRPG
VKEAVKTCLAAGITVRMVTGDNINTAKAIAKECGILTDTGLAIEGPDFRTKSPQELEEII
PKLQVMARSSPLDKHKLVTQLRNVFKEVVAVTGDGTNDAPALAEADIGLAMGIAGTEVAK
ESADVIVMDDNFKTIVNVARWGRAVYINIQKFVQFQLTVNVVALMINFISACISGNAPLT
TVQLLWVNLIMDTLGALALATEPPHDGLMKRPPIGRNVSIITKTMWRNIIGQSIYQIIVL
VILQFDGKHLLKLSGSDATKILNTFIFNTFVLCQVFNEINSRDMEKINVFKGIFSSWIFL
AVMFSTVVFQIVIVEFLGTFANTVPLSWELWLASILIGAASLVIAVILKCIPVETKKDDN
TAKHHDGYEPLPSGPDLA
Download sequence
Identical sequences B9NAY3
3694.fgenesh4_pg.C_scaffold_220000011 POPTR_0001s05790.1|PACid:18238028 XP_006368579.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]