SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s11630.1|PACid:18234932 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s11630.1|PACid:18234932
Domain Number 1 Region: 59-147,292-420,947-1174
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.83e-52
Family Calcium ATPase, transmembrane domain M 0.025
Further Details:      
 
Domain Number 2 Region: 414-438,693-801,872-942
Classification Level Classification E-value
Superfamily HAD-like 7.01e-34
Family Meta-cation ATPase, catalytic domain P 0.046
Further Details:      
 
Domain Number 3 Region: 541-701,735-745
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1e-21
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0097
Further Details:      
 
Domain Number 4 Region: 152-215,250-290
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000706
Family Calcium ATPase, transduction domain A 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s11630.1|PACid:18234932
Sequence length 1255
Sequence
MHGSSRRTKGKVRWSKLYSFSCFRPHTSDPDSAQELIGQPGFSRVVFCNEPQVHKRKPYK
YTNNSVSTKKYTAVTFLPKALFEQFRRVANLYFLLTAALSITSLAPVKPVSLIAPLVFVV
GISMLKEAVEDWYRFLQDLNVNTRTVKAHAGNGLFVDKLWREISVGDVVKVNKDEYFSSD
LLLLSSSYEDGVCYVETMNLDGETNLKIKRCLEVTLDLNEDAKFSEFKATTRCEDPNPSL
YTFVGNLEFENKIYPLSPSQILLRDSKLRNTDYVYGAVIFSGHDTKVVRNSTMSPSKRSR
LEKKMDKVIYLLFSMLLLISLVTSIGSAVVIKSDMSQWWYLSLEDSDPLFDPSNPLKSGF
LQFIRALILYGYLIPISLYVSIEIVKVLQAKFINKDKKMYDEATCKSVQARTSNLNEELG
QVEIILSDKTGTLTCNQMEFRKCSIAGISYGGNINEVDIAASKRMNTDIEAYRSSIDQSD
TTSQSLEMSEFSVADIITQEAILRGQENADNLNARNSRLSDVRKESVIRVIKGFNFRDDR
LMNNQWIYRSDLFDMTMFFRVMALCHTGIPVEDGQTDKLKYEAESPEEVAFLIASQEFGF
QFFQRTQSLMTLKELDPSSGKQVKREYKLLNLLEFSSFRKRMSVIVRDEDGKIYLLCKGA
DSIIFDRLADNGGAYQEATTSHLSNYAEDGFRTLAFAYRVLELAEYEQWNSIFMQAKTTV
GPEREELLEHATEMIEKELILLGVAAVEDKLQKGVVECIDKLAQAGMKIWLLTGDKKETA
INIGFSCSLLRQDMKQFHVCLSKETESKNQLKAMKEEILHQIESSYQVMCQDSNKYSPFA
LVLDGRALEIALKSDVRDQFLQLAVNCASVICCRVSPKQKALITRLVKEYTGKTTLAIGD
GANDVGMIQEADIGVGISGMEGMQAVMASDFSLPQFRFLERLLIVHGHWCYKRISKMVLY
FVYKNIAFGLTLFYYEIFTNFSGDSLYDDWYMVMFNVLLTSLPVISLGVFEQDVSSDVCL
QFPSLYRQGQRNIIFSWSRIVGWILNGTVAASVVFLANIYIFSPAAFRQEGNVADITHFG
AIMYTCIIWTVNCQIALIITHFTWIQHLFIWGSILLWYIFAVAYGALPPDYSQRGFNIIT
ESIGSTPKYWIATFLVIVVALLPYFTHIAFQRLLYPMDDHIIQEMKHCKKDVTENQMWLR
EQRNSQRSTQVGFSARVDARIRSFKEGLSLKRISIYKSVTNTPFYKSWTSSPIFS
Download sequence
Identical sequences B9GK47
3694.fgenesh4_pg.C_LG_I000711 XP_002297933.1.11743 POPTR_0001s11630.1|PACid:18234932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]