SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s12750.1|PACid:18235859 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  POPTR_0001s12750.1|PACid:18235859
Domain Number - Region: 57-130,197-272
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00209
Family Calcium ATPase, transmembrane domain M 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s12750.1|PACid:18235859
Sequence length 426
Sequence
MYNTSTPMPTHQLSDSNRRIMGSHNDNRARNLRVYQAWKGNNIFCLGGRLVFGPDVRSLF
LTILLIMIPVVLFSAFVSRRLIEDFQHQLGDYIVVICAVLTAYVIILLFLTSARDPGIIP
RNLHPPEDEGSSISADWPGSQVSGPSLPPTKDVMVNGMVVKVKYCQTCMLYRSPRCSHCS
ICNNCVERFDHHCPWVGQCIGKRNYRFFFMFVSSTTILCLYVLAFCWVNIRKIMDTDHCD
IWRAFLKSPVSGILVLYTFICAWFVGGLTAFHLYLICTNQTTYENFRYRYDGKMNPYNLG
CVRNVLEVFFTKIPKSKNKFRAKVLVDSSSGYAASMPMSHVLSPEVPKRSFDIEVGKRQA
VADEDFEDLQSQIDSIGGLERCGTQPRHANWDHKANWEITPDIQVLAAEFGMEPGLADGQ
KISRDH
Download sequence
Identical sequences B9GMW2
POPTR_0001s12750.1|PACid:18235859 XP_002299362.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]