SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s13800.5|PACid:18236705 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s13800.5|PACid:18236705
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 6.02e-38
Family Chlorophyll a-b binding protein 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s13800.5|PACid:18236705
Sequence length 156
Sequence
MLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDTTTLFIVELFFIGWAEGRRWADILK
PGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVM
GAWFQHIYTGTGPIDNLFAHLADPGHATVFSAFTPK
Download sequence
Identical sequences U5GSP1
POPTR_0001s13800.2|PACid:18236703 POPTR_0001s13800.3|PACid:18236704 POPTR_0001s13800.5|PACid:18236705 POPTR_0001s13800.6|PACid:18236706 XP_006368875.1.11743 XP_006368876.1.11743 XP_006368877.1.11743 XP_006368878.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]