SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s14430.1|PACid:18234323 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s14430.1|PACid:18234323
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily SNARE-like 1.71e-27
Family Synatpobrevin N-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 125-192
Classification Level Classification E-value
Superfamily SNARE fusion complex 7.33e-24
Family SNARE fusion complex 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s14430.1|PACid:18234323
Sequence length 219
Sequence
MGQQTLIYSFVARGTVLLAEYTEFKGNFTGIAAQCLEKLPASNNKFTYNCDGHTFNYLVE
NGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYSGGKAATAVAKSLNGEFGSKLKGHMQY
CVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLRSQAQDFRQQG
TKMRRKMWIQNMKIKLIVLGIIIALILIIVLSICHGFNC
Download sequence
Identical sequences B9GMF2
XP_002297816.2.11743 POPTR_0001s14430.1|PACid:18234323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]