SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s14700.1|PACid:18237042 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s14700.1|PACid:18237042
Domain Number 1 Region: 14-131,228-322,636-846
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.27e-85
Family Calcium ATPase, transmembrane domain M 0.0055
Further Details:      
 
Domain Number 2 Region: 324-634
Classification Level Classification E-value
Superfamily HAD-like 2.14e-36
Family Meta-cation ATPase, catalytic domain P 0.0007
Further Details:      
 
Domain Number 3 Region: 132-228
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.35e-28
Family Calcium ATPase, transduction domain A 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s14700.1|PACid:18237042
Sequence length 950
Sequence
MVLSLQEIKNENVDLDRIPVSEVFQQLQCTKEGLSTEEGQKRLQIFGPNKLEEKKESKLW
KFLGFMWNPLSWVMEGAAIVAIVLANGEGKPPDWQDFLGIVVLLLMNSTISFYEENSAGN
AAAALMAGLALKTKVLRDGRWIEQEAAVLVPGDVISIKLGDIIPADARLLEGDPLKIDQS
ALTGESLPVTKKPGDEVFSGSTCKHGEIEAVVIATGVHSFFGKAAHLVDSTNKVGHFQKV
LISIGNFCIISIVVGIIIEALVMWPIQRRKYRDGIDNILVLLIGGIPIAMPTVLSVTMAI
GSHWLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNILTVDKSLVEVFVNDVDKDTLI
LLGARASRVENQDAIDACIVGMLADPEEARESITEVHFLPFNPVEKRTAITYIDSDGNWH
RVSKGAPEQIIALCNLREDVERKANVIIDKFAERGLRSLAVCRQIVPEKTKESPGGPWEF
VGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLG
LHPDDSTAALPVDELIEKADGFAGVFPEHKFEIVRRLQARKHICGMTGDGVNDAPALKKA
DIGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG
FLLLALIWKFDFSPFMILIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVILGTY
LALMTVLFFWVAHSSDFFSDKFGVRSIRNNRDELASAIYLQVSIVSQALIFVTRSRSWSF
VECPGGYLAGAFVLAQLIATLITVYCNWGFARIHGIGWGWAVVIWLYSIIFYIPLDFLKF
IIRYALSGRAWDNLLQNKTAFTSKKDYGKGERMAKWSAAQRTIDGVHPPEGSELYRDKSN
HRELSSIAEQAKMRAEVARLRELHTLEGHAELLVKLKGLDNETVQQHYSV
Download sequence
Identical sequences B9GMD1
XP_002297804.2.11743 POPTR_0001s14700.1|PACid:18237042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]