SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s15900.1|PACid:18235769 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s15900.1|PACid:18235769
Domain Number 1 Region: 664-683,741-990
Classification Level Classification E-value
Superfamily HAD-like 7.28e-61
Family Meta-cation ATPase, catalytic domain P 0.00018
Further Details:      
 
Domain Number 2 Region: 466-551
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.11e-20
Family Calcium ATPase, transduction domain A 0.0041
Further Details:      
 
Domain Number 3 Region: 56-129
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 3.8e-20
Family HMA, heavy metal-associated domain 0.00063
Further Details:      
 
Domain Number 4 Region: 140-213
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 7.85e-19
Family HMA, heavy metal-associated domain 0.00034
Further Details:      
 
Domain Number 5 Region: 403-449,552-659,933-974
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000000772
Family Calcium ATPase, transmembrane domain M 0.025
Further Details:      
 
Weak hits

Sequence:  POPTR_0001s15900.1|PACid:18235769
Domain Number - Region: 212-275
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00238
Family HMA, heavy metal-associated domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s15900.1|PACid:18235769
Sequence length 1010
Sequence
MRDLQLTQAAGTRKSPPAMISAGEEDADDMKEDVRLLDSYESLGDNDNSHRIVIEEDGFK
RIQVRVTGMTCAACSNSVESALKSVDGVFRASVALLQNKADVVFDPALVKDDDIKNAIED
AGFEAEILSEPIKLKTKPNGTLLGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATS
LGEVEYDPIVISKDDIVNAIEDAGFDASLVQSSQHDKIVLGVAGIFSEVDVQLLEGILSM
LKGVRQFRYHWISSELEVLFDPEVLGSRSLVDGVEGGSNGKFKLHPINPYSRMTSKDVGE
TSVMFRLFLSSLFLSIPIFFMRVICPYVPLLSSLLLWRCGPFLMGDWLKWALVSVVQFVI
GKRFYVAAGRALRNGSTNMDVLVALGTSASYFYSVCALLYGAVTGFWSPTYFETSSMLIT
FVLLGKYLECLAKGKTSDAIKKLVELAPATALLVVKDKGGRCIGEREIDSLLIQPSDTLK
VLPGTKVPADGVVVWGSSYINESMVTGESVPVLKEVSSSVIGGTMNLHGALHIKATKVGS
DAVLSQIISLVETAQMSKAPIQKFADYVASIFVPIVVGLSLVTFFSWYISGILGAYPEEW
LPENGTYFVFSLMFSISVVVIACPCALGLATPTAVMVATGVGANNGVLIKGGEALERAQK
IKYVIFDKTGTLTQGKASVTDAKVFTGMGRGEFLRWVASAEASSEHPLAKAIVEYARHFH
FFDEPSATSQTPSRESTISGWLLDVSDFLALPGRGVKCFVDGKQVLVGNRKLMIESGIAI
PDQVEHFVVELEESAKTGVLVAFDDKIIGVLGIADPLKREAAVVIEGLLKMGVKPVMVTG
DNWRTARAVAKEVGIQDVRAEVMPAGKADVIHSFQKDGSIVSMVGDGINDSPALAAADIG
MAIGAGTDIAIEAADYVLMRNNLEDVITAIDLSRKTFTRIRLNYIFAMAYNVIAIPIAAG
ALFPSLGIMLPPWVAGACMALSSVSVVCSSLLLRRYRKPRLTTILEITAE
Download sequence
Identical sequences U5GT72
POPTR_0001s15900.1|PACid:18235769 XP_006369037.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]