SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s16150.1|PACid:18239326 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s16150.1|PACid:18239326
Domain Number 1 Region: 21-138,235-329,642-852
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.75e-89
Family Calcium ATPase, transmembrane domain M 0.0055
Further Details:      
 
Domain Number 2 Region: 331-387,421-640
Classification Level Classification E-value
Superfamily HAD-like 1.24e-39
Family Meta-cation ATPase, catalytic domain P 0.00066
Further Details:      
 
Domain Number 3 Region: 138-235
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-28
Family Calcium ATPase, transduction domain A 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s16150.1|PACid:18239326
Sequence length 950
Sequence
MAEDLEKPLLNPESFNREGIDLERLPLEEVFEQLRTSHRGLSSEDAEARLMIFGPNKLEE
KPENKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGQGPDWQDFVGIICLLIINSTISFV
EENNAGNAASALMARLAPKTKVLRDGQWKEQDAAILVPGDIVSIKLGDIIPADSRLLEGD
SLKIDQATLTGESLPVTKRTGDEVYSGSTCKQGEIEAVVIATGVNSFFGKAAHLVDSTEV
VGHFQKVLTAIGNFCICSIAVGMILEIIIMFPVQHRSYRDGINNLLVLLIGGIPIAMPTV
LSVTLAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNRLTVDRNLIEVFNKD
MDKDMIVLLAARASRLENQDAIDAAIVNMLADPKEARENIREVHFLPFNPVDKRTAITYI
DSDGNWYRASKGAPEQILNMSKEKDEISGKVHAIIEKFAERGLRSLGVAFQEVPEKTRES
PGGPWTFCGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMY
PSSTLLGRDRDENEALPVDELIEKADGFAGVFPEHKYEIVKILQEKKHVVGMTGDGVNDA
PALKKADIGIAVADSTDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSIT
IRIVLGFALLALIWEYDFPPFMVLIIAILNDGTIMTISQDRVKPSPRPDSWKLEEIFATG
IVIGTYLALVTVLFYWIVIDTNFFETHFHVRSISSNTEEVSSAVYLQVSIISQALIFVTR
SQSWSFLERPGILLMCAFVVAQLVATIIAVYAHISFAYIRGIGWGWAGVIWLYSLVFYVP
LDIIKFTIRYALSGEAWNLLFDRKTAFSSKKDYGKEDREAKWILSQRSLQGLMATDQDFN
GRRSTLIAEQARRRAEIARLGEIHTLRGHVESVVRLKNLDLNLIQTAHTV
Download sequence
Identical sequences U5GVZ5
XP_006369068.1.11743 POPTR_0001s16150.1|PACid:18239326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]