SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s16590.1|PACid:18236567 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s16590.1|PACid:18236567
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily SNARE-like 3.52e-35
Family Synatpobrevin N-terminal domain 0.0000207
Further Details:      
 
Domain Number 2 Region: 130-197
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000309
Family SNARE fusion complex 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s16590.1|PACid:18236567
Sequence length 218
Sequence
MVKLTMIARVTDGLPLAEGLDDGRDVKDAEMYKQQVKALFKNLASGHNDASRMSVETGPY
VFHYIIEGRVCYLTMCDRSYPKKLAFQYLEDLKYEFERVNGAQIETAARPYAFIKFDTFI
QKTKKLYQDTRTQRNVAKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSQMSSRLTSESRI
YAEKARDLNRQALIRKWAPVAIVLGVVFLLFWVKTKLW
Download sequence
Identical sequences B9N7F9
XP_006369115.1.11743 POPTR_0001s16590.1|PACid:18236567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]