SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s20440.1|PACid:18237313 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s20440.1|PACid:18237313
Domain Number 1 Region: 31-100,245-377,891-1116
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.7e-49
Family Calcium ATPase, transmembrane domain M 0.012
Further Details:      
 
Domain Number 2 Region: 371-395,636-744,816-886
Classification Level Classification E-value
Superfamily HAD-like 2.71e-34
Family Meta-cation ATPase, catalytic domain P 0.076
Further Details:      
 
Domain Number 3 Region: 484-648
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.14e-24
Family Metal cation-transporting ATPase, ATP-binding domain N 0.011
Further Details:      
 
Domain Number 4 Region: 101-168,203-243
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000000000000034
Family Calcium ATPase, transduction domain A 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s20440.1|PACid:18237313
Sequence length 1189
Sequence
MPPWKLWVPRFKRLSLSPPLPLPLSPPRLHCQALFEQFHRVANFYFLVAAGLSLTAVAPF
SPVSMIAPLAFVVGISMLKEALEDWHRFAQDMKVNSRKASVHKGDGVFGYKPWQKIQVGD
VVKVEKDQFFPADLLLLSASYDDGVSYVETMNLDGETNLKVKRSLEVTLPLEDDEAFKNF
TGIIKCEDPNPSLYTFIGNFEYERQVYPLDPSQILLRDSKLRNTAYVYGVVIFTGFDSKV
MQNSTKSPSKRSKIEKKMDKIIYILLSLLLLISSISSIGFAVKIKLQMPDWWYMQPKPKN
PDNDSLYNPDQPSKSGLAHLVTALILYGYLIPISLYVSIEIVKVFQARFINQDIQMYDEE
SGNTAQARTSNLNEELGQVDTILSDKTGTLTCNQMDFLKCSIAGTAYGVRSSEVELAAAK
QMAMDLEEQDTQITNGSRYRKSAHNSWEDSRGGPEIELESVITSKGENDQKPAIKGFSFE
DNKLMNGNWLKEPNTEVILLFFRILAICQTAVPELNEETGMFTYEAESPDEAAFLAAARE
FGFEFCKRTQSSVFIREKYAHPGQLIEREFKILNLLEFTSQRKRMSVIVRDEDGQILLLC
KGADSIIFDRLSKNGRMYETTTAKHLNDYGEVGLRTLALAYKKLDESEYSAWNNEFVKAK
TSISADRDAMLERVADMMEKDLILVGATAVEDKLQKGVPQCIDKLAQAGLKIWVLTGDKM
ETAINIGFSCSLLRQGMKQIFITVMNSDAVAQESKQAVKENILMQITNASQMVKLEKDPH
AAFALIIDGKTLSYALEDDMKHQFLALAVVCASVICCRVSPKQKALVTRLVKEGTGKTTL
AIGDGANDVGMIQEADIGVGISGVEGMQAVMASDFSISQFRFLERLLVVHGHWCYKRIAQ
MICYFFYKNIAFGLTLFYFEAFTAFSGQSVYNDWYMLLFNVILTSLPVISLGVFEQDVSS
EVCLQFPALYQQGPKNLFFDWYRILGWMGNGLYTSLVIFILNIMIFYNQAFRAEGQTADM
AAMGATMFSCIICAVNCQIALTMSHFTWIQHLFVWGSVATWYLFLLLFGMLPPYYSEDAH
KILVEALGPAPIYWCTTLLVTVACILPYLAHISFQRCFNPMDHHIIQEIKYYKKDVKDQH
MWRRERSKARQETKIGFTARVDAKIRQLKGKLQKKSSTVILPNRMPSPC
Download sequence
Identical sequences POPTR_0001s20440.1|PACid:18237313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]