SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s22670.1|PACid:18238026 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s22670.1|PACid:18238026
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily SNARE-like 8.24e-32
Family Synatpobrevin N-terminal domain 0.006
Further Details:      
 
Domain Number 2 Region: 121-187
Classification Level Classification E-value
Superfamily SNARE fusion complex 3.35e-19
Family SNARE fusion complex 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s22670.1|PACid:18238026
Sequence length 220
Sequence
MAIIYAVVARGTVVLSEFSAVTGNTGAVARRILEKLPSEADSRLCFSQDRYIFHILRSDG
LTFLCMANDTFGRRIPFTYLEDIHMRFMKNYGRVAHYAPAYAMNDEFSRVLHQQMEFFSS
NPSADTLSRVRGEVGEIRTIMVENIEKILERGDRIELLVDKTATMQDGAFHFKKQSKGLR
RALWMKNAKLLALLTCVIVLLLYIIIAACCGGITLPSCRS
Download sequence
Identical sequences B9GI08
XP_002298281.1.11743 XP_011006060.1.28252 POPTR_0001s22670.1|PACid:18238026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]