SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s23990.1|PACid:18236933 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s23990.1|PACid:18236933
Domain Number 1 Region: 5-43,158-268,687-951
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.75e-111
Family Calcium ATPase, transmembrane domain M 0.000000258
Further Details:      
 
Domain Number 2 Region: 272-292,470-741
Classification Level Classification E-value
Superfamily HAD-like 2.36e-53
Family Meta-cation ATPase, catalytic domain P 0.000027
Further Details:      
 
Domain Number 3 Region: 281-535
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.01e-44
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00034
Further Details:      
 
Domain Number 4 Region: 42-153
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.09e-27
Family Calcium ATPase, transduction domain A 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s23990.1|PACid:18236933
Sequence length 969
Sequence
MEITAFVEPLVIFLILIVNAIVGVWQESNAEKALEALKEIQSEHATVIRDAKKFSSLPAK
ELVPGDIVELRVGDKVPADMRVLHLISSTLRVEQGSLTGESEAVSKTVKPVAENTDIQGK
KCMVFAGTTVVNGNCMCLVMATGMNTEIGKVHSQIHEAAQNEEDTPLKKKLNEFGEVLTV
LIGIVCAVVWLINVKYFLTWEYVDGWPKNFKFSFEKCTYYFEIAVALAVAAIPEGLPAVI
TTCLALGTRKMAQKNALVRKLPSVETLGCTTVICSDKTGTLTTNQMAVSKLVAMGSRVGT
LRAFNVEGTTYSPFDGKIEDWPVGRMDSNLQMIAKIAAVCNDADVEQSGNHYVAGGMPTE
AALKVKSPSKIGFTIFKLDVVPVISLSVGVLALTCTFLVYLACCQLWNKMEQRIATLEFD
RDRKSMGVIVNSISHKKSLLVKGAVENLLDRSTSIQLLDGSVVALDQYSKDLILQSLHEM
STSALRCLGFAYKEDLSEFETYNGDEDHPAHQLLLEPRNYSSIESNLTFVGLAGLRDPPR
KEVRQAIEDCRAAGIRVMVITGDNKHTAEAICREIGVFGPYDDISSQSLTGKEFMDHRDK
KTHLRHSGGLLISRAEPRHKQEIVRLLKEDGEVVAMTGDGVNDAPALKLADIGIAMGIAG
TEVAKEASDMVLADDNFSTIVAAVGEGRSIYNNMKAFIRYMISSNIGEVASIFLTAALGI
PEGMIPVQLLWVNLVTDGPPATALGFNPPDGDVMKKPPRRSDDSLINTWILFRYLVIGLY
VGIATVGVFIIWYTHHTFMGIDLSGDGHSLVTYSQLANWGQCGSWKDFSVSPFTAGSQVF
SFDANPCEYFRSGKIKASTLSLSVLVAIEMFNSLNALSEDCSLLRMPPWVNPWLLLAMSI
SFGLHALILYVPFLAQVFGIVPLSFNEWLLVLAVAFPVILIDEVLKFVGRCTRGLRQSNS
TRHSKHKAE
Download sequence
Identical sequences U5GUF5
XP_006369497.1.11743 POPTR_0001s23990.1|PACid:18236933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]