SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s34920.1|PACid:18235842 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s34920.1|PACid:18235842
Domain Number 1 Region: 51-139,285-417,901-1129
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.31e-57
Family Calcium ATPase, transmembrane domain M 0.02
Further Details:      
 
Domain Number 2 Region: 418-434,628-735,808-907
Classification Level Classification E-value
Superfamily HAD-like 6.25e-30
Family Predicted hydrolases Cof 0.041
Further Details:      
 
Domain Number 3 Region: 430-693
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.05e-24
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0084
Further Details:      
 
Domain Number 4 Region: 141-207,242-282
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.96e-16
Family Calcium ATPase, transduction domain A 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s34920.1|PACid:18235842
Sequence length 1145
Sequence
MTMREGLHFSKLLPFSCFKSQPSENHGLIGQKGYSRVVYCNDPDNPEAIKLNYRGNYVSN
TKYTALNFIPKSLFEQFRRVANFYFLVVACVSFSPLAPYTAPSVAVPLLVVIGATMAKEG
IEDWRRRKQDIEANNRRVKVYHKNSTFHETRWKKLRVGDIVKVSKDEYFPADLLLLSSSY
EDGICYVETMNLDGETDLKLKHALEVTSSLREEESLKKFMAMIKCEDPNEKLYSFVGTLY
YNGYDYPLLPRQILLRDSKLRNTEFIYGVVIFTGHDTKVMQNAVDPPPSKRSKIERRMDK
IVYLLFSMLVLISFIGSIFFGIETTKDFRGGRFRRWYLRPDDTTVFFDPKRAPISAFFHF
LTGLMLYGYLIPISLYVSIEIVKVLQSIFINQDQDMYYKETNKPAQARTSNLNEELGQVE
YIMSDKTGTLTCNSMEFVKCSIAGVAYGYGMTEVERAVARIAGDGPLEADDTRNSGNSIK
GFNFRDERIMNGKWVNEPHSDVIQKFFRILAVCNTAVPERNKETGEISYEAESPDEAAFV
IAAREIGFELFKRKQSSISLHELVNGEKVTRVYQILQILEFSSYRKRMSAIVRTMENKIL
LLCKGADSVIFERLSYEGRLFEAKTKEHVKKFAEAGLRTMLLAYRELGEGEHKEWAAEFS
NAKANVTAYRDVLMDEIADKIERDLILLGATAIEDKLQKGVPECIDKLAKATIKIWVLTG
DKMETAINIGYACSLLREGMKLIIITLDLPEIKALERQGDMEAISKASFQSVQKQLEDGK
IQVDSAKEGRNEFGLVVEGKSLAFALDNKLEKNFLNLALACASVLCCRSTPKQKALVTRL
VKMDSSKTTLAIGDGGNDVSMLQEADIGVGISGVEGMEAVMSSDFAIAQFCFLERLLLVH
GHWCYRRIAMMVCYFFYKNITFGFTLFWFEAYASFSGQPAYNDWYMSFYNVFFTSLPVIA
LGVFDQDVSARLCLKYPLLYREGIKNILFSWPHILLWMCNGVLTSIIIFFFTINSMINQA
FRRDGQVVDYEILGATMYTCVVWAVNCQIALSIHYFTWIQHFFIWGSIAFWYIFMVIYGF
LPPGVSTTAHKVFVEACAPSILYWLVTLLVVISTLLPYFSYRAFQSRFLPMYHDDLISVR
RRPRG
Download sequence
Identical sequences B9GHQ9
POPTR_0001s34920.1|PACid:18235842 XP_002298522.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]