SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s39270.1|PACid:18238296 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s39270.1|PACid:18238296
Domain Number 1 Region: 625-684
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000298
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0051
Further Details:      
 
Weak hits

Sequence:  POPTR_0001s39270.1|PACid:18238296
Domain Number - Region: 185-299,567-616
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00589
Family Calcium ATPase, transmembrane domain M 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s39270.1|PACid:18238296
Sequence length 808
Sequence
MEEEDPPSKLIGHFLHRQKASGEFCLDMDLEMMTHLQNDTVVPHKNLPPVSESPTTNTNR
VSFDPNPPGSSESLRRRRDFKNSSPRNQNNGDGEILKCSSSNDGSFCSNSSFKRKSSLLK
ERTKSRLMDPPPHPPEKSGRVVVGRSGQLKSGFLGKGSVVDEEEDDPLLEEDLPDEYKKD
KLDIWILLEWLSLIVIIAALVCSLAIPYLRTKNLWRLRLWKWEVLVLVLICGRLVSGWVI
KVIVFFIERNFLLRKRVLYFVYGIRNAVQNCLWLGLVLIAWHYLFDKRVERETRSTTLGF
VTKVLVCLVVGTLLWLVKTLVVKVLASSFHVSTYFDRIQESLFNQYVIETLSGPPLVEMK
RNEEEEERLLAEVKKLQNAGATVPPGLKATASPSPSQSAKVIGSGSFQKSARIGTPIPKL
SRALSNKVDEGDEGITINHLHKLNPKNVSAWNMKRLVNIIRHGALSTLDEQIQNSNHGDE
ESSTKIRSEFEAKAAARNIFTNVARQGSRYIYLDDIMRFMQEDEASKAMSLFEGASESNK
ISKKCLKNWVVNAFRERRALALTLNDTKTAVNKLHRMVNFLVGIVIAIIWLLILGIATSK
FLLFLSSQLLLVAFIFGNTCKTVFESIIFLFVIHPFDVGDRCEIDGVQMVVEEMNILTTV
FLRFDNQKIIITNSVLATKAIGNYYRSPDMGDAVEFLIHLVTPAEKIAIVKQRISSYIES
KKDHWYPSPLIIFKDAEDLTRVRIAVWLTHRMNHQDMGERFIRRSLLLDEMMKIFRELDI
QYRLLPLDINVRALPPVMSDRLPANWTN
Download sequence
Identical sequences U5GW72
XP_006370070.1.11743 POPTR_0001s39270.1|PACid:18238296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]