SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0002s04240.1|PACid:18244844 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0002s04240.1|PACid:18244844
Domain Number 1 Region: 29-95
Classification Level Classification E-value
Superfamily SNARE fusion complex 4.91e-16
Family SNARE fusion complex 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0002s04240.1|PACid:18244844
Sequence length 123
Sequence
MNSRRDVRNNRAALFDGIEEGGIRASSSYSSHEIDEQDNERALEGLEDRVSLLKRLSGDI
NEEVDSHNLMLDRMGNDMDSSRGVLSGTMDRFKMVFETKSSRRMLTLVASFVVIFLIIYY
LTR
Download sequence
Identical sequences B9GS38
XP_002300787.1.11743 3694.estExt_Genewise1_v1.C_LG_II2504 POPTR_0002s04240.1|PACid:18244844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]