SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0002s04840.1|PACid:18246693 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0002s04840.1|PACid:18246693
Domain Number 1 Region: 111-229,330-448,812-1019
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.1e-118
Family Calcium ATPase, transmembrane domain M 0.00095
Further Details:      
 
Domain Number 2 Region: 452-472,605-867
Classification Level Classification E-value
Superfamily HAD-like 1.37e-56
Family Meta-cation ATPase, catalytic domain P 0.0004
Further Details:      
 
Domain Number 3 Region: 461-659
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 2.18e-35
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0071
Further Details:      
 
Domain Number 4 Region: 229-328
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.59e-26
Family Calcium ATPase, transduction domain A 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0002s04840.1|PACid:18246693
Sequence length 1048
Sequence
MTSSKPTHIDSSILLASTISQAQKRWRIAYLAICSVRAMLSLVREMTSETNSHQYSGILH
SVSYTVLDTEPTGSKNQKKGRESTFNISDDDQMKFTKMVKEKDLASLNNLGGVEGVATAF
GINSKTGITGHDEEVRRRREMFGPNTYHKPPPKGFLFFALEAFRDTTILILLVCAALALG
FGIKQHGVKEGWYEGGSIFVAVFLVIVVSASSNFRQETQFDKLSKISNNIKVDVLRNERR
QQISIFDIVVGDIVFLNIGDQIPADGLFLDGHSLEVDESSMTGESDHVAVNTQENPFLFS
GSKIADGYARMLVTSVGMNTAWGEMMSSITRDSNERTPLQARLDKLTSSIGKVGLSVAFV
VLVVMLVRYFTGNTKDDKGKKEYIGSRTDTDDVLNAVVRIVAAAVTIVVVAIPEGLPLAV
TLTLAYSMKRMMADQAMVRKLSACETMGSATVICTDKTGTLTLNKMKVTKFWLGQEPIEE
DSYKTIAPSILEVFHQGVSLNTTGSVYKSATGSVPEFSGSPTEKAILSWAVSELGMDMEK
LKESCTILHVETFNSEKKRSGVSIRKKADNTVHVHWKGAAEMILALCSSYYDSRGSIKSM
DEDERSKIEKIIQGMAASSLRCIAFAHKRITEEGMKDNDGEPHQRLQEDGLTLLGIVGLK
DPCRIGAKKAVEICKAAGVSVKMITGDNIFTAKAIATECGILELKSQVDSEEVVEGVVFR
NYTDEQRMEKVDKIRVMARSSPFDKLLMVQCLRQKGHVVAVTGDGTNDAPALKEADIGLS
MGIQGTEVAKESSDIVILDDNFTSVATVLRWGRCVYNNIQKFIQFQLTVNVAALVINFIA
AVSAGEVPLTAVQLLWVNLIMDTLGALALATERPTDELMEMSPVGRTAPLITNIMWRNLL
AQAFYQITILLTLQFAGESIFNVSAEVNDTLIFNTFVLCQVFNEFNARNMEKQNVFKGIH
RNHLFLGIIATTIVLQVVMVEFLKKFASTERLNWWQWVTCIAFAAVSWPIGWFVKLIPVS
GKPFLSHLKRPVATYKRVMHSIYFRGTS
Download sequence
Identical sequences B9GSH9
XP_002300816.2.11743 POPTR_0002s04840.1|PACid:18246693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]