SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0002s10280.1|PACid:18247056 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0002s10280.1|PACid:18247056
Domain Number 1 Region: 20-88
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000131
Family SNARE fusion complex 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0002s10280.1|PACid:18247056
Sequence length 121
Sequence
GAAPYRSREGLSTRPVASSDEIQLRIDPIHWDLDDEITGLRSQVRQLRNVAQVIESEAKY
EKDFLETLQMTVMKAQVGVKNNLRKLNKSIIKNGGNHIVHVVVFALFGFLVVYLWSKMSR
R
Download sequence
Identical sequences B9GV17
XP_002302327.2.11743 POPTR_0002s10280.1|PACid:18247056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]