SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0002s11820.1|PACid:18246301 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0002s11820.1|PACid:18246301
Domain Number 1 Region: 1-18,419-656
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.53e-72
Family Calcium ATPase, transmembrane domain M 0.000000115
Further Details:      
 
Domain Number 2 Region: 31-268
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.96e-50
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00000772
Further Details:      
 
Domain Number 3 Region: 257-418
Classification Level Classification E-value
Superfamily HAD-like 7.59e-44
Family Meta-cation ATPase, catalytic domain P 0.00000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0002s11820.1|PACid:18246301
Sequence length 666
Sequence
MARLNAIVRSLPSVETLGCTTVICSDKTGTLTTNMMSVSKICVVHSVHHGPTIAEYSVSG
TSYAPEGIIFGSSGMQIQFPAQLPSLLHVAMCSAICNESILQYNPDKGSYEKIGESTEVA
LRVLAEKVGLPGFDSMPSALHMLSKHERASYCNHYWESQFKKVSVLEFSRDRKMMSVLCS
QKQKEIMFSKGAPGSIVSRCSNILCNDDGSTVPFSAAVRDELESRFRSFAGKETLRCLAL
AFKQMPIGQQTLSFEDEKDLTFIGLVGMLDPPREEVRNAMLSCMTAGIRVIVVTGDNKST
AESLCNKIGAFDHLEDFAGHSYTASEFEELPALQRTLALQRMTLFTRVEPSHKRMLVEAL
QHQNEVVAMTGDGVNDAPALKKADIGIAMGSGTAVAKSASDMVLADDNFASIVAAVAEGR
AIYNNTKQFIRYMISSNIGEVVCIFVAAVIGIPDTLAPVQLLWVNLVTDGLPAIAIGFNK
QDSDVMKAKPRKVNEAVVSGWLFFRYLVIGAYVGLATVAGFVWWFVHSDSGPKLPFKELM
NFDSCSTRETNYPCSIFDDRHPSTVSMTVLVVVEMFNALNNLSENQSLLVIPPWSNLWLV
ASIVLTMLLHILILYVHPLSTLFSVMPLSWIEWKVVLYLSFPVIIIDEVLKFFARNSKEI
LFRENN
Download sequence
Identical sequences B9GNN5
POPTR_0002s11820.1|PACid:18246301 XP_002302402.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]