SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0002s24200.1|PACid:18245161 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0002s24200.1|PACid:18245161
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily SNARE-like 3.36e-27
Family Synatpobrevin N-terminal domain 0.0083
Further Details:      
 
Domain Number 2 Region: 125-192
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.2e-24
Family SNARE fusion complex 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0002s24200.1|PACid:18245161
Sequence length 219
Sequence
MGQQSLIYSFVARGTVILADYTDFSGNFAGIAAQCLQKLPATNNKFTYSCDGHTFNYLVD
NGFTYCVVAVESVGRQIPIAYLERIKEDFTNRYGGGKAAIAVANGLKKEFGPKLKEQMQF
CMDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQVFRQQG
GQIKRKMWWQNMKIKLIVLAILIVLILIIVLSICGGFKC
Download sequence
Identical sequences B9GNJ1
XP_002303031.1.11743 POPTR_0002s24200.1|PACid:18245161 3694.eugene3.00002461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]