SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s01840.1|PACid:18217057 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s01840.1|PACid:18217057
Domain Number 1 Region: 164-293
Classification Level Classification E-value
Superfamily HAD-like 2.25e-31
Family Meta-cation ATPase, catalytic domain P 0.0014
Further Details:      
 
Domain Number 2 Region: 112-185
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.00000019
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s01840.1|PACid:18217057
Sequence length 323
Sequence
MDLLHCQHTFCRNLGCQKTRIVILNRKISLGIVGNSQLKLKTPSIVVLVINLRRKERIRC
GSIELRIQDMICASLAAHAALATTDPSATNLSIDTCAARAYGYKIEFVVGYDVTDGTFME
EPGSGAVATIENKVVSVGTLDWIQRHGVCENPFQEVEDIKNQSVVYVGVDNTLAGLIYFE
DQIREDARHVVESLSCQGINVYMLSGDRKKNAEYVASLVGIPKEKVLSGVKPDEKKKFIS
ELQKDQNIVAMVGDGINDAAALAESHVGVAMGEGVGAASEVSSIVLMGNRLSQRYGTQVL
CFAFSYDAPSILVAAKIIALSLM
Download sequence
Identical sequences U5GHR9
POPTR_0003s01840.1|PACid:18217057 XP_006385231.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]