SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s01850.1|PACid:18217413 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s01850.1|PACid:18217413
Domain Number 1 Region: 47-135
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.7e-24
Family Calcium ATPase, transduction domain A 0.0043
Further Details:      
 
Domain Number 2 Region: 248-302
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.0000000000327
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0083
Further Details:      
 
Domain Number 3 Region: 136-239
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000955
Family Calcium ATPase, transmembrane domain M 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s01850.1|PACid:18217413
Sequence length 330
Sequence
MLIAFVLLGRNLEQRAKIKAASDMTGLLSVLPTKARLVVNGDATDLGSIVEVPCSSLSVG
DQIVVLPGDRVPADGTVRAGRSTIDESSFTGEPLPVTKLPGSHVSAGSINLNGTLTIEVK
RPGGETAMGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAISAATFMFWSMFGTHILP
AALNQGNPVSLALQLSCSVLVVACPCALGLATPTAVLVGTSLGATRGLLLRGGNVLEKFS
MVNSVVFDKTGTLTIGRPVVTKVVFMYIDKFEVLKLAAGVESNTIHPVGKAIVEAARAAS
CTSVKSNMDTSRMTVLKTIGDVGQERRYRN
Download sequence
Identical sequences B9H034
XP_002304094.2.11743 POPTR_0003s01850.1|PACid:18217413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]