SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s03300.1|PACid:18216149 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s03300.1|PACid:18216149
Domain Number 1 Region: 42-91
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000567
Family SNARE fusion complex 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s03300.1|PACid:18216149
Sequence length 147
Sequence
MAGESVTQLIKDSMSYRRYATENACKSYTYSMFPTWSNIYKIRVVQDTVNVGRETAEALK
AQTEQMSRIVNELDSIHFSIKKASKMVKEIGRQVATDKCIMALLFLVVIGVIAIIIVKLV
NPNNKDIRDIPGLAPPAQSRRLLWNPN
Download sequence
Identical sequences U5GI77
XP_006385386.1.11743 POPTR_0003s03300.1|PACid:18216149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]