SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s04180.1|PACid:18216886 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s04180.1|PACid:18216886
Domain Number 1 Region: 54-144,289-417,929-1155
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.79e-56
Family Calcium ATPase, transmembrane domain M 0.015
Further Details:      
 
Domain Number 2 Region: 411-435,674-780,854-924
Classification Level Classification E-value
Superfamily HAD-like 8.68e-34
Family Meta-cation ATPase, catalytic domain P 0.069
Further Details:      
 
Domain Number 3 Region: 522-686
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.01e-25
Family Metal cation-transporting ATPase, ATP-binding domain N 0.01
Further Details:      
 
Domain Number 4 Region: 145-212,247-287
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000000157
Family Calcium ATPase, transduction domain A 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s04180.1|PACid:18216886
Sequence length 1227
Sequence
MTRGRIRARLRRSHLHPFSCLRPNANNSEGPHPLLGPGFSRIVHCNQPHKHQKKPLKYCS
NYISTTKYNIVTFLPKALYEQFHRLANLYFLVAAVLSLTAVAPFSPLSMILPLAFVVGLS
MAKEALEDWRRFTQDMKVNSRKASVHKGGGVFGYKPWQKIQVGDVVKVEKDQFFPADLLL
LSTSYDDGICYVETMNLDGETNLKVKRSLEVTLPLEDDESFKNFTGIIKCEDPNPNLYTF
VGNFEYERQVYPLDPTQILLRDSKLRNTSYVYGVVIFTGFDSKVMQNSTKSPSKRSKIEK
KMDKIIYILLSLLVLISSISSIGFAVKIKFQMPDWTYMQPRNENDLYDPDNPGKSGVAHL
ITALILYGYLIPISLYVSIEIVKVFQARFINQDIHMYDEETGNTAQARTSNLNEELGQVD
TILSDKTGTLTCNQMDFLKCSIAGTAYGVCSSEIEVAAAKQMAMDLEEQDTQNTNVSRYG
KSAHKEDSRGGPEIELESVITSKCDNDQKPAIKGFNFEDSRLMDGKWLNERNREVLLLFF
RILAICQTAVPELNEETGMFTYEAESPDEAAFLAAAREFGFEFYKRTQSSVFIREKYAHP
GRLIEREFKILNLLEFTSKRKRMSVIVRDEDGQILLLCKGADSVIFDRLSKNGRIYEETT
VKHLNEYGEAGLRTLALAYKKLDESEYSAWNNEFVKVKTSISTDREAMLERVADMMEKDL
ILVGATAVEDKLQKGVPQCIDKLAQAGLKIWVLTGDKMETAINIGFSCSLLRQGMKRICI
TVMNSDVVAQDSKQAVKENILMQITNSSQMVKLQKDPHAAFALIIDGKSLSYALEDDMKH
HFLALAVGCASVICCRVSPKQKALVTRLVKEGTKKTTLAIGDGANDVGMIQEADIGVGIS
GVEGMQAVMASDFSISQFRFLERLLVVHGHWCYKRIAQMICYFFYKNIAFGLTLFYFEAF
TAFSGQSVYNDWYMLLFNVILTSLPVISLGVFEQDVSSEVCLQFPALYQQGTKNLFFDWY
RILGWMGNGLYSSLVIFILNIVIFYNQAFRAGGQTADMAAVGATMFSCIICAVNCQIALT
MSHFTWIQHLFVWGSVATWYLFLLLYGLMPPSYSGDVYRLLVEVLGPAPIYWSTILLVTV
ACIVPYLVHISFQRCFNPMDHHIIQEIKYYKKDVEDQHMWRRERSKARQETKIGFTARVD
AKIRQFKGKLRKNSSTLVSQNCMPSPS
Download sequence
Identical sequences B9MWV5
3694.eugene3.00440139 POPTR_0003s04180.1|PACid:18216886 XP_006385412.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]