SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s04180.2|PACid:18216887 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s04180.2|PACid:18216887
Domain Number 1 Region: 411-435,674-780,854-924
Classification Level Classification E-value
Superfamily HAD-like 4.8e-34
Family Meta-cation ATPase, catalytic domain P 0.069
Further Details:      
 
Domain Number 2 Region: 54-144,289-417,929-955
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.09e-27
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 
Domain Number 3 Region: 522-686
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.27e-25
Family Metal cation-transporting ATPase, ATP-binding domain N 0.01
Further Details:      
 
Domain Number 4 Region: 145-212,247-287
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000000115
Family Calcium ATPase, transduction domain A 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s04180.2|PACid:18216887
Sequence length 967
Sequence
MTRGRIRARLRRSHLHPFSCLRPNANNSEGPHPLLGPGFSRIVHCNQPHKHQKKPLKYCS
NYISTTKYNIVTFLPKALYEQFHRLANLYFLVAAVLSLTAVAPFSPLSMILPLAFVVGLS
MAKEALEDWRRFTQDMKVNSRKASVHKGGGVFGYKPWQKIQVGDVVKVEKDQFFPADLLL
LSTSYDDGICYVETMNLDGETNLKVKRSLEVTLPLEDDESFKNFTGIIKCEDPNPNLYTF
VGNFEYERQVYPLDPTQILLRDSKLRNTSYVYGVVIFTGFDSKVMQNSTKSPSKRSKIEK
KMDKIIYILLSLLVLISSISSIGFAVKIKFQMPDWTYMQPRNENDLYDPDNPGKSGVAHL
ITALILYGYLIPISLYVSIEIVKVFQARFINQDIHMYDEETGNTAQARTSNLNEELGQVD
TILSDKTGTLTCNQMDFLKCSIAGTAYGVCSSEIEVAAAKQMAMDLEEQDTQNTNVSRYG
KSAHKEDSRGGPEIELESVITSKCDNDQKPAIKGFNFEDSRLMDGKWLNERNREVLLLFF
RILAICQTAVPELNEETGMFTYEAESPDEAAFLAAAREFGFEFYKRTQSSVFIREKYAHP
GRLIEREFKILNLLEFTSKRKRMSVIVRDEDGQILLLCKGADSVIFDRLSKNGRIYEETT
VKHLNEYGEAGLRTLALAYKKLDESEYSAWNNEFVKVKTSISTDREAMLERVADMMEKDL
ILVGATAVEDKLQKGVPQCIDKLAQAGLKIWVLTGDKMETAINIGFSCSLLRQGMKRICI
TVMNSDVVAQDSKQAVKENILMQITNSSQMVKLQKDPHAAFALIIDGKSLSYALEDDMKH
HFLALAVGCASVICCRVSPKQKALVTRLVKEGTKKTTLAIGDGANDVGMIQEADIGVGIS
GVEGMQAVMASDFSISQFRFLERLLVVHGHWCYKRIAQMVIIKRLYHASFYAFDMFASTA
LTCTPHA
Download sequence
Identical sequences B9GVD1
POPTR_0003s04180.2|PACid:18216887 XP_002303211.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]