SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s06750.3|PACid:18216584 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s06750.3|PACid:18216584
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily SNARE-like 1.65e-35
Family Synatpobrevin N-terminal domain 0.0000203
Further Details:      
 
Domain Number 2 Region: 130-197
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000136
Family SNARE fusion complex 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s06750.3|PACid:18216584
Sequence length 218
Sequence
MVKLTMIARVTDGLPLAEGLDDGRDVKDAEMYKQQVKALFKNLASGHNDASRMSIETGPY
IFHYIIEGRICYLTMCDRSYPKKLAFQYLEDLKNEFERVNGPQIETAARPYAFIKFDTFI
QKTKKLYQDTRTQRNIAKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSQMSSRLTSESRV
YADKARDLNRQALIRKWAPVAIVLGVVFLLFWIKTKLW
Download sequence
Identical sequences B9GXQ0
XP_002304234.1.11743 XP_006385526.1.11743 XP_006385527.1.11743 POPTR_0003s06750.1|PACid:18216582 POPTR_0003s06750.2|PACid:18216583 POPTR_0003s06750.3|PACid:18216584 3694.estExt_fgenesh4_pm.C_LG_III0135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]